![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Bacterial alpha-amylase [51447] (10 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [51450] (2 PDB entries) Uniprot P00691 |
![]() | Domain d1baga2: 1bag A:1-347 [28707] Other proteins in same PDB: d1baga1 complexed with ca |
PDB Entry: 1bag (more details), 2.5 Å
SCOPe Domain Sequences for d1baga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1baga2 c.1.8.1 (A:1-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} ltapsiksgtilhawnwsfntlkhnmkdihdagytaiqtspinqvkegnqgdksmsnwyw lyqptsyqignrylgteqefkemcaaaeeygikvivdavinhttfdyaaisnevksipnw thgntqiknwsdrwdvtqnsllglydwntqntqvqsylkrfleralndgadgfrfdaakh ielpddgsygsqfwpnitntsaefqygqilqdsasrdaayanymdvtasnyghsirsalk nrnlgvsnishyasdvsadklvtwveshdtyanddeestwmsdddirlgwaviasrsgst plffsrpegggngvrfpgksqigdrgsalfedqaitavnrfhnvmag
Timeline for d1baga2: