Lineage for d2foma1 (2fom A:49-95)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. Family g.96.1.1: Flavivirus non-structural protein NS2B-like [310635] (2 proteins)
  6. Protein Flavivirus non-structural protein NS2B [310766] (2 species)
  7. Species Dengue virus 2 [TaxId:11060] [311021] (1 PDB entry)
  8. Domain d2foma1: 2fom A:49-95 [287067]
    Other proteins in same PDB: d2foma2, d2foma3, d2fomb1
    complexed with cl, gol

Details for d2foma1

PDB Entry: 2fom (more details), 1.5 Å

PDB Description: dengue virus ns2b/ns3 protease
PDB Compounds: (A:) Polyprotein

SCOPe Domain Sequences for d2foma1:

Sequence, based on SEQRES records: (download)

>d2foma1 g.96.1.1 (A:49-95) Flavivirus non-structural protein NS2B {Dengue virus 2 [TaxId: 11060]}
adleleraadvrweeqaeisgsspilsitisedgsmsikneeeeqtl

Sequence, based on observed residues (ATOM records): (download)

>d2foma1 g.96.1.1 (A:49-95) Flavivirus non-structural protein NS2B {Dengue virus 2 [TaxId: 11060]}
adleleraadvrweeqaeisgsspilsisikneeeeqtl

SCOPe Domain Coordinates for d2foma1 are not available.

Timeline for d2foma1:

Domains from same chain:
(mouse over for more information)
d2foma2, d2foma3
Domains from other chains:
(mouse over for more information)
d2fomb1