Lineage for d1b0ia2 (1b0i A:1-354)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818157Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1818273Protein Bacterial alpha-amylase [51447] (10 species)
  7. 1818305Species Pseudoalteromonas haloplanktis [TaxId:228] [51449] (9 PDB entries)
  8. 1818313Domain d1b0ia2: 1b0i A:1-354 [28706]
    Other proteins in same PDB: d1b0ia1
    complexed with ca, cl

Details for d1b0ia2

PDB Entry: 1b0i (more details), 2.4 Å

PDB Description: alpha-amylase from alteromonas haloplanctis
PDB Compounds: (A:) protein (alpha-amylase)

SCOPe Domain Sequences for d1b0ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0ia2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis [TaxId: 228]}
tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfdaskhva
asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypk
vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntad

SCOPe Domain Coordinates for d1b0ia2:

Click to download the PDB-style file with coordinates for d1b0ia2.
(The format of our PDB-style files is described here.)

Timeline for d1b0ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b0ia1