Lineage for d1b0ia2 (1b0i A:1-354)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64721Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (12 proteins)
  6. 64752Protein Bacterial alpha-amylase [51447] (5 species)
  7. 64753Species Alteromonas haloplanctis [51449] (3 PDB entries)
  8. 64756Domain d1b0ia2: 1b0i A:1-354 [28706]
    Other proteins in same PDB: d1b0ia1

Details for d1b0ia2

PDB Entry: 1b0i (more details), 2.4 Å

PDB Description: alpha-amylase from alteromonas haloplanctis
PDB Compounds: (A:)

SCOP Domain Sequences for d1b0ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0ia2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Alteromonas haloplanctis}
tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfdaskhva
asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypk
vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntad

SCOP Domain Coordinates for d1b0ia2:

Click to download the PDB-style file with coordinates for d1b0ia2.
(The format of our PDB-style files is described here.)

Timeline for d1b0ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b0ia1