Lineage for d1b0ia2 (1b0i A:1-354)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18735Protein Bacterial alpha-amylase [51447] (4 species)
  7. 18736Species Alteromonas haloplanctis [51449] (3 PDB entries)
  8. Domain d1b0ia2: 1b0i A:1-354 [28706]
    Other proteins in same PDB: d1b0ia1

Details for d1b0ia2

PDB Entry: 1b0i (more details), 2.4 Å

PDB Description: alpha-amylase from alteromonas haloplanctis
PDB Compounds: (A:)

SCOP Domain Sequences for d1b0ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0ia2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Alteromonas haloplanctis}
tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfdaskhva
asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypk
vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntad

SCOP Domain Coordinates for d1b0ia2 are not available.

Timeline for d1b0ia2:

Domains from same chain:
(mouse over for more information)
d1b0ia1