Lineage for d1blia2 (1bli A:3-393)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2438625Protein Bacterial alpha-amylase [51447] (10 species)
  7. 2438628Species Bacillus licheniformis [TaxId:1402] [51448] (9 PDB entries)
  8. 2438630Domain d1blia2: 1bli A:3-393 [28702]
    Other proteins in same PDB: d1blia1
    complexed with ca, na

Details for d1blia2

PDB Entry: 1bli (more details), 1.9 Å

PDB Description: bacillus licheniformis alpha-amylase
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1blia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blia2 c.1.8.1 (A:3-393) Bacterial alpha-amylase {Bacillus licheniformis [TaxId: 1402]}
lngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqadvgygaydly
dlgefhqkgtvrtkygtkgelqsaikslhsrdinvygdvvinhkggadatedvtavevdp
adrnrvisgehlikawthfhfpgrgstysdfkwhwyhfdgtdwdesrklnriykfqgkaw
dwevsnefgnydylmyadidydhpdvaaeikrwgtwyanelqldgfrldavkhikfsflr
dwvnhvrektgkemftvaeywsydlgalenylnktnfnhsvfdvplhyqfhaastqgggy
dmrkllngtvvskhplksvtfvdnhdtqpgqslestvqtwfkplayafiltresgypqvf
ygdmygtkgdsqreipalkhkiepilkarkq

SCOPe Domain Coordinates for d1blia2:

Click to download the PDB-style file with coordinates for d1blia2.
(The format of our PDB-style files is described here.)

Timeline for d1blia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1blia1