Lineage for d1vjs_2 (1vjs 3-393)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64721Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (12 proteins)
  6. 64752Protein Bacterial alpha-amylase [51447] (5 species)
  7. 64762Species Bacillus licheniformis [TaxId:1402] [51448] (3 PDB entries)
  8. 64764Domain d1vjs_2: 1vjs 3-393 [28701]
    Other proteins in same PDB: d1vjs_1

Details for d1vjs_2

PDB Entry: 1vjs (more details), 1.7 Å

PDB Description: structure of alpha-amylase precursor
PDB Compounds: ( :)

SCOP Domain Sequences for d1vjs_2:

Sequence, based on SEQRES records: (download)

>d1vjs_2 c.1.8.1 (3-393) Bacterial alpha-amylase {Bacillus licheniformis}
lngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqadvgygaydly
dlgefhqkgtvrtkygtkgelqsaikslhsrdinvygdvvinhkggadatedvtavevdp
adrnrvisgehlikawthfhfpgrgstysdfkwhwyhfdgtdwdesrklnriykfqgkaw
dwevsnengnydylmyadidydhpdvaaeikrwgtwyanelqldgfrldavkhikfsflr
dwvnhvrektgkemftvaeywqndlgalenylnktnfnhsvfdvplhyqfhaastqgggy
dmrkllnstvvskhplkavtfvdnhdtqpgqslestvqtwfkplayafiltresgypqvf
ygdmygtkgdsqreipalkhkiepilkarkq

Sequence, based on observed residues (ATOM records): (download)

>d1vjs_2 c.1.8.1 (3-393) Bacterial alpha-amylase {Bacillus licheniformis}
lngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqadvgygaydly
dlgefhqkgtvrtkygtkgelqsaikslhsrdinvygdvvinhkggadatedvtavevdp
adrnrvisgehlikawthfhfpgrgstysdfkwhwyhfdgtdwdesrklnriykfqgkay
dylmyadidydhpdvaaeikrwgtwyanelqldgfrldavkhikfsflrdwvnhvrektg
kemftvaeywqndlgalenylnktnfnhsvfdvplhyqfhaastqgggydmrkllnstvv
skhplkavtfvdnhdtqpgqslestvqtwfkplayafiltresgypqvfygdmygtkgds
qreipalkhkiepilkarkq

SCOP Domain Coordinates for d1vjs_2:

Click to download the PDB-style file with coordinates for d1vjs_2.
(The format of our PDB-style files is described here.)

Timeline for d1vjs_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vjs_1