SCOP 1.69: Domain d1a80__: 1a80 -

Lineage for d1a80__ (1a80 -)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
   Common fold covers whole protein structure

6. Protein 2,5-diketo-D-gluconic acid reductase A [51443] (2 species)

7. Species Corynebacterium sp. [TaxId:1720] [51444] (3 PDB entries)

8. Domain d1a80__: 1a80 - [28700]

Details for d1a80__

PDB Entry: 1a80, 2.1 Å

PDB Description: native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. complexed with nadph

SCOP Domain Sequences for d1a80__:

Sequence; same for both SEQRES and ATOM records:

>d1a80__ c.1.7.1 (-) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp.}
tvpsivlndgnsipqlgygvfkvppadtqraveealevgyrhidtaaiygneegvgaaia
asgiarddlfittklwndrhdgdepaaaiaeslaklaldqvdlylvhwptpaadnyvhaw
ekmielraagltrsigvsnhlvphlerivaatgvvpavnqielhpayqqreitdwaaahd
vkieswgplgqgkydlfgaepvtaaaaahgktpaqavlrwhlqkgfvvfpksvrrerlee
nldvfdfdltdteiaaidamdpgdgsgrvsahpdevd

Timeline for d1a80__:

• d1a80__ first appeared (with stable ids) in SCOP 1.55
  
• d1a80__ appears in SCOP 1.67
  
• d1a80__ appears in SCOP 1.71
  
• d1a80__ appears in the current release, SCOPe 2.08, called d1a80a_