Lineage for d1a80__ (1a80 -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384272Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 384273Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (14 proteins)
    Common fold covers whole protein structure
  6. 384274Protein 2,5-diketo-D-gluconic acid reductase A [51443] (2 species)
  7. 384275Species Corynebacterium sp. [TaxId:1720] [51444] (3 PDB entries)
  8. 384277Domain d1a80__: 1a80 - [28700]
    complexed with nap

Details for d1a80__

PDB Entry: 1a80 (more details), 2.1 Å

PDB Description: native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. complexed with nadph

SCOP Domain Sequences for d1a80__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a80__ c.1.7.1 (-) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp.}
tvpsivlndgnsipqlgygvfkvppadtqraveealevgyrhidtaaiygneegvgaaia
asgiarddlfittklwndrhdgdepaaaiaeslaklaldqvdlylvhwptpaadnyvhaw
ekmielraagltrsigvsnhlvphlerivaatgvvpavnqielhpayqqreitdwaaahd
vkieswgplgqgkydlfgaepvtaaaaahgktpaqavlrwhlqkgfvvfpksvrrerlee
nldvfdfdltdteiaaidamdpgdgsgrvsahpdevd

SCOP Domain Coordinates for d1a80__:

Click to download the PDB-style file with coordinates for d1a80__.
(The format of our PDB-style files is described here.)

Timeline for d1a80__: