Lineage for d1a80__ (1a80 -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) 
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (6 proteins) 
Protein 2,5-diketo-D-gluconic acid reductase A [51443] (1 species) Species Corynebacterium sp. [TaxId:1720] [51444] (1 PDB entry) 
Domain d1a80__: 1a80 - [28700]
Details for d1a80__
PDB Entry: 1a80 (more details), 2.1 Å
PDB Description: native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. complexed with nadph
SCOP Domain Sequences for d1a80__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a80__ c.1.7.1 (-) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp.}
tvpsivlndgnsipqlgygvfkvppadtqraveealevgyrhidtaaiygneegvgaaia
asgiarddlfittklwndrhdgdepaaaiaeslaklaldqvdlylvhwptpaadnyvhaw
ekmielraagltrsigvsnhlvphlerivaatgvvpavnqielhpayqqreitdwaaahd
vkieswgplgqgkydlfgaepvtaaaaahgktpaqavlrwhlqkgfvvfpksvrrerlee
nldvfdfdltdteiaaidamdpgdgsgrvsahpdevd
SCOP Domain Coordinates for d1a80__:
Click to download the PDB-style file with coordinates for d1a80__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a80__:
- d1a80__ appears in SCOP 1.57
- d1a80__ appears in the current release, SCOPe 2.08, called d1a80a_
View in 3D