Lineage for d1afsa_ (1afs A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18659Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 18660Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (6 proteins)
  6. 18664Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (1 species)
  7. 18665Species Rat (Rattus norvegicus) [TaxId:10116] [51440] (3 PDB entries)
  8. 18666Domain d1afsa_: 1afs A: [28694]

Details for d1afsa_

PDB Entry: 1afs (more details), 2.5 Å

PDB Description: recombinant rat liver 3-alpha-hydroxysteroid dehydrogenase (3-alpha-hsd) complexed with nadp and testosterone

SCOP Domain Sequences for d1afsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus)}
mdsislrvalndgnfipvlgfgttvpekvakdevikatkiaidngfrhfdsaylyeveee
vgqairskiedgtvkredifytsklwstfhrpelvrtclektlkstqldyvdlyiihfpm
alqpgdiffprdehgkllfetvdicdtweamekckdaglaksigvsnfncrqlerilnkp
glkykpvcnqvechlylnqskmldyckskdiilvsyctlgssrdktwvdqkspvllddpv
lcaiakkykqtpalvalryqlqrgvvplirsfnakrikeltqvfefqlasedmkaldgln
rnfrynnakyfddhpnhpf

SCOP Domain Coordinates for d1afsa_:

Click to download the PDB-style file with coordinates for d1afsa_.
(The format of our PDB-style files is described here.)

Timeline for d1afsa_: