Lineage for d2f8tb3 (2f8t B:315-487)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130626Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2130803Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) (S)
  5. 2130804Family c.44.3.1: PIWI domain N-terminal [310609] (4 proteins)
    PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The C-terminal half is (c.55.3.10)
  6. 2130805Protein Argonaute homologue Aq_1447 [310684] (1 species)
  7. 2130806Species Aquifex aeolicus [TaxId:63363] [310901] (4 PDB entries)
  8. 2130811Domain d2f8tb3: 2f8t B:315-487 [286910]
    Other proteins in same PDB: d2f8ta1, d2f8ta4, d2f8tb1, d2f8tb4
    protein/RNA complex

Details for d2f8tb3

PDB Entry: 2f8t (more details), 3.1 Å

PDB Description: Crystal structure of Aa-Ago with externally-bound siRNA
PDB Compounds: (B:) Argonaute protein

SCOPe Domain Sequences for d2f8tb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8tb3 c.44.3.1 (B:315-487) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
klnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvykklewrkeeflk
elinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlvivfleeypkvdpyk
sfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlaktgnipyk

SCOPe Domain Coordinates for d2f8tb3:

Click to download the PDB-style file with coordinates for d2f8tb3.
(The format of our PDB-style files is described here.)

Timeline for d2f8tb3: