![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) ![]() |
![]() | Family c.44.3.1: PIWI domain N-terminal [310609] (4 proteins) PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The C-terminal half is (c.55.3.10) |
![]() | Protein Argonaute homologue Aq_1447 [310684] (1 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [310901] (4 PDB entries) |
![]() | Domain d2f8tb3: 2f8t B:315-487 [286910] Other proteins in same PDB: d2f8ta1, d2f8ta4, d2f8tb1, d2f8tb4 protein/RNA complex |
PDB Entry: 2f8t (more details), 3.1 Å
SCOPe Domain Sequences for d2f8tb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8tb3 c.44.3.1 (B:315-487) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]} klnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvykklewrkeeflk elinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlvivfleeypkvdpyk sfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlaktgnipyk
Timeline for d2f8tb3: