Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.15: PIWI domain C-terminal [310608] (4 proteins) PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The N-terminal half is (c.44.3.1) |
Protein Argonaute homologue Aq_1447 [310683] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [310900] (4 PDB entries) |
Domain d2f8ta4: 2f8t A:488-706 [286909] Other proteins in same PDB: d2f8ta1, d2f8ta3, d2f8tb1, d2f8tb3 protein/RNA complex |
PDB Entry: 2f8t (more details), 3.1 Å
SCOPe Domain Sequences for d2f8ta4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8ta4 c.55.3.15 (A:488-706) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]} lkeiegkvdafvgidisritrdgktvnavaftkifnskgelvryyltsypafgeklteka igdvfslleklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiikrnnprff snekfikgyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqilsltlmny ssfqpiklpatvhysdkitklmlrgiepikkegdimywl
Timeline for d2f8ta4: