Lineage for d2f8sa4 (2f8s A:488-706)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887170Family c.55.3.15: PIWI domain C-terminal [310608] (4 proteins)
    PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The N-terminal half is (c.44.3.1)
  6. 2887171Protein Argonaute homologue Aq_1447 [310683] (1 species)
  7. 2887172Species Aquifex aeolicus [TaxId:63363] [310900] (4 PDB entries)
  8. 2887174Domain d2f8sa4: 2f8s A:488-706 [286905]
    Other proteins in same PDB: d2f8sa1, d2f8sa3, d2f8sb1, d2f8sb3
    protein/RNA complex

Details for d2f8sa4

PDB Entry: 2f8s (more details), 3 Å

PDB Description: Crystal structure of Aa-Ago with externally-bound siRNA
PDB Compounds: (A:) Argonaute protein

SCOPe Domain Sequences for d2f8sa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8sa4 c.55.3.15 (A:488-706) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
lkeiegkvdafvgidisritrdgktvnavaftkifnskgelvryyltsypafgeklteka
igdvfslleklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiikrnnprff
snekfikgyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqilsltlmny
ssfqpiklpatvhysdkitklmlrgiepikkegdimywl

SCOPe Domain Coordinates for d2f8sa4:

Click to download the PDB-style file with coordinates for d2f8sa4.
(The format of our PDB-style files is described here.)

Timeline for d2f8sa4: