SCOP 1.65: Domain d1cwn__: 1cwn -

Lineage for d1cwn__ (1cwn -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (10 proteins)
   Common fold covers whole protein structure

6. Protein Aldose reductase (aldehyde reductase) [51436] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51438] (8 PDB entries)

8. Domain d1cwn__: 1cwn - [28686]
   complexed with nap

Details for d1cwn__

PDB Entry: 1cwn, 2 Å

PDB Description: crystal structure of porcine aldehyde reductase holoenzyme

SCOP Domain Sequences for d1cwn__:

Sequence; same for both SEQRES and ATOM records:

>d1cwn__ c.1.7.1 (-) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa)}
aascvllhtgqkmpliglgtwksepgqvkaaikyaltvgyrhidcaaiygneleigealt
etvgpgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyaferg
dnpfpknadgtirydathykdtwkalealvakglvralglsnfssrqiddvlsvasvrpa
vlqvechpylaqneliahcqarglevtaysplgssdrawrdpnepvlleepvvqalaeky
nrspaqillrwqvqrkvicipksvtpsripqniqvfdftfspeemkqldalnknlrfivp
mltvdgkrvprdaghplypfndpy

Timeline for d1cwn__:

• d1cwn__ first appeared (with stable ids) in SCOP 1.55
  
• d1cwn__ appears in SCOP 1.63
  
• d1cwn__ appears in SCOP 1.67
  
• d1cwn__ appears in the current release, SCOPe 2.08, called d1cwna_