Lineage for d1az2__ (1az2 -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) 
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (6 proteins) 
Protein Aldose reductase (aldehyde reductase) [51436] (2 species) Species Human (Homo sapiens) [TaxId:9606] [51437] (12 PDB entries) 
Domain d1az2__: 1az2 - [28682]
Details for d1az2__
PDB Entry: 1az2 (more details), 2.9 Å
PDB Description: citrate bound, c298a/w219y mutant human aldose reductase
SCOP Domain Sequences for d1az2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1az2__ c.1.7.1 (-) Aldose reductase (aldehyde reductase) {Human (Homo sapiens)}
srlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqek
lreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgkef
fpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpav
nqiechpyltqekliqycqskgivvtaysplgspdrpyakpedpslledprikaiaakhn
kttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvaall
sctshkdypfheef
SCOP Domain Coordinates for d1az2__:
Click to download the PDB-style file with coordinates for d1az2__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1az2__:
- d1az2__ appears in SCOP 1.57
- d1az2__ appears in the current release, SCOPe 2.08, called d1az2a_
View in 3D