Lineage for d1ads__ (1ads -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570948Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 570949Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 570985Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 570986Species Human (Homo sapiens) [TaxId:9606] [51437] (21 PDB entries)
  8. 570994Domain d1ads__: 1ads - [28671]
    complexed with nap

Details for d1ads__

PDB Entry: 1ads (more details), 1.6 Å

PDB Description: an unlikely sugar substrate site in the 1.65 angstroms structure of the human aldose reductase holoenzyme implicated in diabetic complications

SCOP Domain Sequences for d1ads__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ads__ c.1.7.1 (-) Aldose reductase (aldehyde reductase) {Human (Homo sapiens)}
asrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqe
klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke
ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa
vnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakh
nkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcal
lsctshkdypfheef

SCOP Domain Coordinates for d1ads__:

Click to download the PDB-style file with coordinates for d1ads__.
(The format of our PDB-style files is described here.)

Timeline for d1ads__: