Lineage for d1ads__ (1ads -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18659Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 18660Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (6 proteins)
  6. 18671Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 18672Species Human (Homo sapiens) [TaxId:9606] [51437] (12 PDB entries)
  8. 18673Domain d1ads__: 1ads - [28671]

Details for d1ads__

PDB Entry: 1ads (more details), 1.6 Å

PDB Description: an unlikely sugar substrate site in the 1.65 angstroms structure of the human aldose reductase holoenzyme implicated in diabetic complications

SCOP Domain Sequences for d1ads__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ads__ c.1.7.1 (-) Aldose reductase (aldehyde reductase) {Human (Homo sapiens)}
asrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqe
klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke
ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa
vnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakh
nkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcal
lsctshkdypfheef

SCOP Domain Coordinates for d1ads__:

Click to download the PDB-style file with coordinates for d1ads__.
(The format of our PDB-style files is described here.)

Timeline for d1ads__: