Lineage for d1qrqd_ (1qrq D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1817577Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1817578Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1817859Protein Voltage-dependent K+ channel beta subunit [51434] (1 species)
  7. 1817860Species Norway rat (Rattus norvegicus) [TaxId:10116] [51435] (11 PDB entries)
  8. 1817876Domain d1qrqd_: 1qrq D: [28670]
    complexed with ndp

Details for d1qrqd_

PDB Entry: 1qrq (more details), 2.8 Å

PDB Description: structure of a voltage-dependent k+ channel beta subunit
PDB Compounds: (D:) protein (kv beta2 protein)

SCOPe Domain Sequences for d1qrqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrqd_ c.1.7.1 (D:) Voltage-dependent K+ channel beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagka
evvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdvv
fanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceqa
eyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlkd
kilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmenig
aiqvlpklsssivheidsilgnkpy

SCOPe Domain Coordinates for d1qrqd_:

Click to download the PDB-style file with coordinates for d1qrqd_.
(The format of our PDB-style files is described here.)

Timeline for d1qrqd_: