Lineage for d1exba_ (1exb A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236155Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 236156Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (8 proteins)
    Common fold covers whole protein structure
  6. 236211Protein Voltage-dependent K+ channel beta subunit [51434] (1 species)
  7. 236212Species Rat (Rattus norvegicus) [TaxId:10116] [51435] (2 PDB entries)
  8. 236213Domain d1exba_: 1exb A: [28666]
    Other proteins in same PDB: d1exbe_
    complexed with ndp

Details for d1exba_

PDB Entry: 1exb (more details), 2.1 Å

PDB Description: structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels

SCOP Domain Sequences for d1exba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exba_ c.1.7.1 (A:) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus)}
lqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagka
evvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdvv
fanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceqa
eyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlkd
kilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmenig
aiqvlpklsssivheidsilgnkpys

SCOP Domain Coordinates for d1exba_:

Click to download the PDB-style file with coordinates for d1exba_.
(The format of our PDB-style files is described here.)

Timeline for d1exba_: