Lineage for d1exba_ (1exb A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) 
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (6 proteins) 
Protein Voltage-dependent K+ channel beta subunit [51434] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [51435] (2 PDB entries) 
Domain d1exba_: 1exb A: [28666]
Other proteins in same PDB: d1exbe_
Details for d1exba_
PDB Entry: 1exb (more details), 2.1 Å
PDB Description: structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels
SCOP Domain Sequences for d1exba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exba_ c.1.7.1 (A:) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus)}
lqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagka
evvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdvv
fanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceqa
eyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlkd
kilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmenig
aiqvlpklsssivheidsilgnkpys
SCOP Domain Coordinates for d1exba_:
Click to download the PDB-style file with coordinates for d1exba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1exba_:
- d1exba_ appears in SCOP 1.57
- d1exba_ appears in the current release, SCOPe 2.08
View in 3D
