SCOPe 2.06: Domain d1b54a_: 1b54 A:

Lineage for d1b54a_ (1b54 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
   circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand

5. Family c.1.6.2: "Hypothetical" protein ybl036c [51427] (1 protein)
   automatically mapped to Pfam PF01168

6. Protein "Hypothetical" protein ybl036c [51428] (1 species)
   structure from BNL's human proteome project

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51429] (2 PDB entries)

8. Domain d1b54a_: 1b54 A: [28664]
   complexed with plp

Details for d1b54a_

PDB Entry: 1b54, 2.1 Å

PDB Description: crystal structure of a yeast hypothetical protein-a structure from bnl's human proteome project

PDB Compounds: (A:) yeast hypothetical protein

SCOPe Domain Sequences for d1b54a_:

Sequence, based on SEQRES records:

>d1b54a_ c.1.6.2 (A:) "Hypothetical" protein ybl036c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gitydedrktqliaqyesvrevvnaeaknvhvnenaskilllvvsklkpasdiqilydhg
vrefgenyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakkl
nesrakfqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklnglmti
gswnvshedskenrdfatlvewkkkidakfgtslklsmgmsadfreairqgtaevrigtd
ifg

Sequence, based on observed residues (ATOM records):

>d1b54a_ c.1.6.2 (A:) "Hypothetical" protein ybl036c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gitydedrktqliaqyesvrevvnaeaknvhskilllvvsklkpasdiqilydhgvrefg
enyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakklnesra
kfqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklnglmtigswen
rdfatlvewkkkidakfgtslklsmgmsadfreairqgtaevrigtdifg

Timeline for d1b54a_:

• d1b54a_ first appeared (with stable ids) in SCOP 1.55, called d1b54__
  
• d1b54a_ appears in SCOPe 2.05
  
• d1b54a_ appears in SCOPe 2.07
  
• d1b54a_ appears in the current release, SCOPe 2.08