Lineage for d1b54__ (1b54 -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64633Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
  5. 64662Family c.1.6.2: "Hypothetical" protein ybl036c [51427] (1 protein)
  6. 64663Protein "Hypothetical" protein ybl036c [51428] (1 species)
  7. 64664Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51429] (2 PDB entries)
  8. 64666Domain d1b54__: 1b54 - [28664]

Details for d1b54__

PDB Entry: 1b54 (more details), 2.1 Å

PDB Description: crystal structure of a yeast hypothetical protein-a structure from bnl's human proteome project

SCOP Domain Sequences for d1b54__:

Sequence, based on SEQRES records: (download)

>d1b54__ c.1.6.2 (-) "Hypothetical" protein ybl036c {Baker's yeast (Saccharomyces cerevisiae)}
gitydedrktqliaqyesvrevvnaeaknvhvnenaskilllvvsklkpasdiqilydhg
vrefgenyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakkl
nesrakfqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklnglmti
gswnvshedskenrdfatlvewkkkidakfgtslklsmgmsadfreairqgtaevrigtd
ifg

Sequence, based on observed residues (ATOM records): (download)

>d1b54__ c.1.6.2 (-) "Hypothetical" protein ybl036c {Baker's yeast (Saccharomyces cerevisiae)}
gitydedrktqliaqyesvrevvnaeaknvhskilllvvsklkpasdiqilydhgvrefg
enyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakklnesra
kfqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklnglmtigswen
rdfatlvewkkkidakfgtslklsmgmsadfreairqgtaevrigtdifg

SCOP Domain Coordinates for d1b54__:

Click to download the PDB-style file with coordinates for d1b54__.
(The format of our PDB-style files is described here.)

Timeline for d1b54__: