Lineage for d1ct5a_ (1ct5 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18625Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
  5. 18654Family c.1.6.2: "Hypothetical" protein ybl036c [51427] (1 protein)
  6. 18655Protein "Hypothetical" protein ybl036c [51428] (1 species)
  7. 18656Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51429] (2 PDB entries)
  8. 18657Domain d1ct5a_: 1ct5 A: [28663]

Details for d1ct5a_

PDB Entry: 1ct5 (more details), 2 Å

PDB Description: crystal structure of yeast hypothetical protein ybl036c-selenomet crystal

SCOP Domain Sequences for d1ct5a_:

Sequence, based on SEQRES records: (download)

>d1ct5a_ c.1.6.2 (A:) "Hypothetical" protein ybl036c {Baker's yeast (Saccharomyces cerevisiae)}
tgitydedrktqliaqyesvrevvnaeaknvhvnenaskilllvvsklkpasdiqilydh
gvrefgenyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakk
lnesrakfqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklnglmt
igswnvshedskenrdfatlvewkkkidakfgtslklsmgmsadfreairqgtaevrigt
difg

Sequence, based on observed residues (ATOM records): (download)

>d1ct5a_ c.1.6.2 (A:) "Hypothetical" protein ybl036c {Baker's yeast (Saccharomyces cerevisiae)}
tgitydedrktqliaqyesvrevvnaeaknvkilllvvsklkpasdiqilydhgvrefge
nyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakklnesrak
fqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklnglmtigswnrd
fatlvewkkkidakfgtslklsmgmsadfreairqgtaevrigtdifg

SCOP Domain Coordinates for d1ct5a_:

Click to download the PDB-style file with coordinates for d1ct5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ct5a_: