SCOPe 2.08: Domain d1ct5a_: 1ct5 A:

Lineage for d1ct5a_ (1ct5 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
   circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand

5. Family c.1.6.2: 'Hypothetical' protein ybl036c [51427] (1 protein)
   automatically mapped to Pfam PF01168

6. Protein 'Hypothetical' protein ybl036c [51428] (1 species)
   structure from BNL's human proteome project

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51429] (2 PDB entries)

8. Domain d1ct5a_: 1ct5 A: [28663]
   complexed with plp

Details for d1ct5a_

PDB Entry: 1ct5, 2 Å

PDB Description: crystal structure of yeast hypothetical protein ybl036c-selenomet crystal

PDB Compounds: (A:) protein (yeast hypothetical protein, selenomet)

SCOPe Domain Sequences for d1ct5a_:

Sequence, based on SEQRES records:

>d1ct5a_ c.1.6.2 (A:) 'Hypothetical' protein ybl036c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tgitydedrktqliaqyesvrevvnaeaknvhvnenaskilllvvsklkpasdiqilydh
gvrefgenyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakk
lnesrakfqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklnglmt
igswnvshedskenrdfatlvewkkkidakfgtslklsmgmsadfreairqgtaevrigt
difg

Sequence, based on observed residues (ATOM records):

>d1ct5a_ c.1.6.2 (A:) 'Hypothetical' protein ybl036c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tgitydedrktqliaqyesvrevvnaeaknvkilllvvsklkpasdiqilydhgvrefge
nyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakklnesrak
fqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklnglmtigswnrd
fatlvewkkkidakfgtslklsmgmsadfreairqgtaevrigtdifg

Timeline for d1ct5a_:

• d1ct5a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ct5a_ appears in SCOPe 2.07