Lineage for d1qu4b2 (1qu4 B:44-283)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829052Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 2829053Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins)
  6. 2829104Protein Eukaryotic ornithine decarboxylase [51423] (3 species)
  7. 2829110Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51426] (5 PDB entries)
    Uniprot P07805
  8. 2829128Domain d1qu4b2: 1qu4 B:44-283 [28660]
    Other proteins in same PDB: d1qu4a1, d1qu4b1, d1qu4c1, d1qu4d1
    complexed with plp

Details for d1qu4b2

PDB Entry: 1qu4 (more details), 2.9 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase
PDB Compounds: (B:) ornithine decarboxylase

SCOPe Domain Sequences for d1qu4b2:

Sequence, based on SEQRES records: (download)

>d1qu4b2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddslar
crlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgt
elgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Sequence, based on observed residues (ATOM records): (download)

>d1qu4b2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristlsvkfg
akvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhi
ldigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

SCOPe Domain Coordinates for d1qu4b2:

Click to download the PDB-style file with coordinates for d1qu4b2.
(The format of our PDB-style files is described here.)

Timeline for d1qu4b2: