Lineage for d1f3tb2 (1f3t B:44-283)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570872Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 570873Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 570916Protein Eukaryotic ornithine decarboxylase [51423] (3 species)
  7. 570922Species Trypanosoma brucei [TaxId:5691] [51426] (5 PDB entries)
  8. 570928Domain d1f3tb2: 1f3t B:44-283 [28656]
    Other proteins in same PDB: d1f3ta1, d1f3tb1, d1f3tc1, d1f3td1

Details for d1f3tb2

PDB Entry: 1f3t (more details), 2 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase (odc) complexed with putrescine, odc's reaction product.

SCOP Domain Sequences for d1f3tb2:

Sequence, based on SEQRES records: (download)

>d1f3tb2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddslar
crlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgt
elgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Sequence, based on observed residues (ATOM records): (download)

>d1f3tb2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristdlsvkf
gakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmh
ildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

SCOP Domain Coordinates for d1f3tb2:

Click to download the PDB-style file with coordinates for d1f3tb2.
(The format of our PDB-style files is described here.)

Timeline for d1f3tb2: