SCOP 1.73: Domain d2toda2: 2tod A:44-283

Lineage for d2toda2 (2tod A:44-283)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
   circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand

5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)

6. Protein Eukaryotic ornithine decarboxylase [51423] (3 species)

7. Species Trypanosoma brucei [TaxId:5691] [51426] (5 PDB entries)

8. Domain d2toda2: 2tod A:44-283 [28651]
   Other proteins in same PDB: d2toda1, d2todb1, d2todc1, d2todd1

Details for d2toda2

PDB Entry: 2tod, 2 Å

PDB Description: ornithine decarboxylase from trypanosoma brucei k69a mutant in complex with alpha-difluoromethylornithine

PDB Compounds: (A:) protein (ornithine decarboxylase)

SCOP Domain Sequences for d2toda2:

Sequence, based on SEQRES records:

>d2toda2 c.1.6.1 (A:44-283) Eukaryotic ornithine decarboxylase {Trypanosoma brucei [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavacnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddslar
crlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgt
elgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Sequence, based on observed residues (ATOM records):

>d2toda2 c.1.6.1 (A:44-283) Eukaryotic ornithine decarboxylase {Trypanosoma brucei [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavacnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristlsvkfg
akvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhi
ldigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Timeline for d2toda2:

• d2toda2 first appeared (with stable ids) in SCOP 1.55
  
• d2toda2 appears in SCOP 1.71
  
• d2toda2 appears in SCOP 1.75
  
• d2toda2 appears in the current release, SCOPe 2.08