Lineage for d2sfpa2 (2sfp A:12-244)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473860Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 473861Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 473862Protein Alanine racemase [51421] (3 species)
  7. 473863Species Bacillus stearothermophilus [TaxId:1422] [51422] (8 PDB entries)
  8. 473872Domain d2sfpa2: 2sfp A:12-244 [28646]
    Other proteins in same PDB: d2sfpa1, d2sfpb1

Details for d2sfpa2

PDB Entry: 2sfp (more details), 1.9 Å

PDB Description: alanine racemase with bound propionate inhibitor

SCOP Domain Sequences for d2sfpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sfpa2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

SCOP Domain Coordinates for d2sfpa2:

Click to download the PDB-style file with coordinates for d2sfpa2.
(The format of our PDB-style files is described here.)

Timeline for d2sfpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2sfpa1