| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.6: PLP-binding barrel [51419] (2 families) ![]() circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
| Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins) |
| Protein Alanine racemase [51421] (1 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [51422] (8 PDB entries) |
| Domain d2sfpa2: 2sfp A:12-244 [28646] Other proteins in same PDB: d2sfpa1, d2sfpb1 |
PDB Entry: 2sfp (more details), 1.9 Å
SCOP Domain Sequences for d2sfpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sfpa2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea
Timeline for d2sfpa2: