![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.6: PLP-binding barrel [51419] (2 families) ![]() circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
![]() | Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins) |
![]() | Protein Alanine racemase [51421] (3 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [51422] (8 PDB entries) |
![]() | Domain d1sfta2: 1sft A:12-244 [28644] Other proteins in same PDB: d1sfta1, d1sftb1 complexed with act, plp |
PDB Entry: 1sft (more details), 1.9 Å
SCOPe Domain Sequences for d1sfta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfta2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]} vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea
Timeline for d1sfta2: