Lineage for d1b3ob1 (1b3o B:10-111,B:232-499)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18612Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (1 family) (S)
  5. 18613Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 18614Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (4 species)
  7. 18615Species Human (Homo sapiens) [TaxId:9606] [51418] (1 PDB entry)
  8. 18617Domain d1b3ob1: 1b3o B:10-111,B:232-499 [28641]
    Other proteins in same PDB: d1b3ob2, d1b3ob3

Details for d1b3ob1

PDB Entry: 1b3o (more details), 2.9 Å

PDB Description: ternary complex of human type-ii inosine monophosphate dehydrogenase with 6-cl-imp and selenazole adenine dinucleotide

SCOP Domain Sequences for d1b3ob1:

Sequence, based on SEQRES records: (download)

>d1b3ob1 c.1.5.1 (B:10-111,B:232-499) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens)}
tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
mdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeXdyplaskdakkqllcga
aigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqviggnvvtaa
qaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvpviadggiq
nvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldamdkhlssqn
ryfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvrammysgel
kfekrtssaqv

Sequence, based on observed residues (ATOM records): (download)

>d1b3ob1 c.1.5.1 (B:10-111,B:232-499) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens)}
tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
mdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeXdyplaskdakkqllcga
aigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqviggnvvtaa
qaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvpviadggiq
nvghiakalalgastvmmgsllaatteapgeydkgsihkfvpyliagiqhscqdigaksl
tqvrammysgelkfekrtssaqv

SCOP Domain Coordinates for d1b3ob1:

Click to download the PDB-style file with coordinates for d1b3ob1.
(The format of our PDB-style files is described here.)

Timeline for d1b3ob1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b3oa1