Lineage for d1b3oa1 (1b3o A:10-109,A:232-499)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080657Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 2080658Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species)
  7. 2080665Species Human (Homo sapiens), type II [TaxId:9606] [51418] (3 PDB entries)
  8. 2080666Domain d1b3oa1: 1b3o A:10-109,A:232-499 [28640]
    Other proteins in same PDB: d1b3ob4
    contains two CBS domains inserted into the common fold, residues 112-231
    complexed with cpr, sae, unx

Details for d1b3oa1

PDB Entry: 1b3o (more details), 2.9 Å

PDB Description: ternary complex of human type-ii inosine monophosphate dehydrogenase with 6-cl-imp and selenazole adenine dinucleotide
PDB Compounds: (A:) protein (inosine monophosphate dehydrogenase 2)

SCOPe Domain Sequences for d1b3oa1:

Sequence, based on SEQRES records: (download)

>d1b3oa1 c.1.5.1 (A:10-109,A:232-499) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens), type II [TaxId: 9606]}
tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
mdtvteagmaiamaltggigfihhnctpefqanevrkvkkXdyplaskdakkqllcgaai
gtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqviggnvvtaaqa
knlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvpviadggiqnv
ghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldamdkhlssqnry
fseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvrammysgelkf
ekrtssaqv

Sequence, based on observed residues (ATOM records): (download)

>d1b3oa1 c.1.5.1 (A:10-109,A:232-499) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens), type II [TaxId: 9606]}
tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
mdtvteagmaiamaltggigfihhnctpefqanevrkvkkXdyplaskdakkqllcgaai
gtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqviggnvvtaaqa
knlidagvdalrvgmgsrpqatavykvseyarrfgvpviadggiqnvghiakalalgast
vmmgsllaatteapgeydkgsihkfvpyliagiqhscqdigaksltqvrammysgelkfe
krtssaqv

SCOPe Domain Coordinates for d1b3oa1:

Click to download the PDB-style file with coordinates for d1b3oa1.
(The format of our PDB-style files is described here.)

Timeline for d1b3oa1: