Lineage for d1zfja1 (1zfj A:2-94,A:221-492)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18612Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (1 family) (S)
  5. 18613Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 18614Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (4 species)
  7. 18621Species Streptococcus pyogenes [TaxId:1314] [51416] (1 PDB entry)
  8. 18622Domain d1zfja1: 1zfj A:2-94,A:221-492 [28638]
    Other proteins in same PDB: d1zfja2, d1zfja3

Details for d1zfja1

PDB Entry: 1zfj (more details), 1.9 Å

PDB Description: inosine monophosphate dehydrogenase (impdh; ec 1.1.1.205) from streptococcus pyogenes

SCOP Domain Sequences for d1zfja1:

Sequence, based on SEQRES records: (download)

>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes}
snwdtkflkkgytfddvllipaeshvlpnevdlktkladnltlnipiitaamdtvtgskm
aiaiaragglgvihknmsiteqaeevrkvkrseXgrllvaaavgvtsdtferaealfeag
adaividtahghsagvlrkiaeirahfpnrtliagniataegaralydagvdvvkvgigp
gsicttrvvagvgvpqvtaiydaaavareygktiiadggikysgdivkalaaggnavmlg
smfagtdeapgeteiyqgrkyktyrgmgsiaamkkgssdryfqgsvneanklvpegiegr
vaykgaasdivfqmlggirsgmgyvgagdiqelhenaqfvemsgaglieshphdvqitne
apnysv

Sequence, based on observed residues (ATOM records): (download)

>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes}
snwdtkflkkgytfddvllipaeshvlpnevdlktkladnltlnipiitaamdtvtgskm
aiaiaragglgvihknmsiteqaeevrkvkrseXgrllvaaavgvtsdtferaealfeag
adaividtahghsagvlrkiaeirahfpnrtliagniataegaralydagvdvvkvgigp
gsicttrvvagvgvpqvtaiydaaavareygktiiadggikysgdivkalaaggnavmlg
smfagtdeapgeteiyqgrkyktyrgmgsiaamkknklvpegiegrvaykgaasdivfqm
lggirsgmgyvgagdiqelhenaqfvemsgaglieshphdvqitneapnysv

SCOP Domain Coordinates for d1zfja1:

Click to download the PDB-style file with coordinates for d1zfja1.
(The format of our PDB-style files is described here.)

Timeline for d1zfja1: