Lineage for d1zfja1 (1zfj A:2-94,A:221-492)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080657Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 2080658Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species)
  7. 2080678Species Streptococcus pyogenes [TaxId:1314] [51416] (1 PDB entry)
  8. 2080679Domain d1zfja1: 1zfj A:2-94,A:221-492 [28638]
    Other proteins in same PDB: d1zfja4
    contains two CBS domains inserted into the common fold
    complexed with imp

Details for d1zfja1

PDB Entry: 1zfj (more details), 1.9 Å

PDB Description: inosine monophosphate dehydrogenase (impdh; ec 1.1.1.205) from streptococcus pyogenes
PDB Compounds: (A:) inosine monophosphate dehydrogenase

SCOPe Domain Sequences for d1zfja1:

Sequence, based on SEQRES records: (download)

>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]}
snwdtkflkkgytfddvllipaeshvlpnevdlktkladnltlnipiitaamdtvtgskm
aiaiaragglgvihknmsiteqaeevrkvkrseXgrllvaaavgvtsdtferaealfeag
adaividtahghsagvlrkiaeirahfpnrtliagniataegaralydagvdvvkvgigp
gsicttrvvagvgvpqvtaiydaaavareygktiiadggikysgdivkalaaggnavmlg
smfagtdeapgeteiyqgrkyktyrgmgsiaamkkgssdryfqgsvneanklvpegiegr
vaykgaasdivfqmlggirsgmgyvgagdiqelhenaqfvemsgaglieshphdvqitne
apnysv

Sequence, based on observed residues (ATOM records): (download)

>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]}
snwdtkflkkgytfddvllipaeshvlpnevdlktkladnltlnipiitaamdtvtgskm
aiaiaragglgvihknmsiteqaeevrkvkrseXgrllvaaavgvtsdtferaealfeag
adaividtahghsagvlrkiaeirahfpnrtliagniataegaralydagvdvvkvgigp
gsicttrvvagvgvpqvtaiydaaavareygktiiadggikysgdivkalaaggnavmlg
smfagtdeapgeteiyqgrkyktyrgmgsiaamkknklvpegiegrvaykgaasdivfqm
lggirsgmgyvgagdiqelhenaqfvemsgaglieshphdvqitneapnysv

SCOPe Domain Coordinates for d1zfja1:

Click to download the PDB-style file with coordinates for d1zfja1.
(The format of our PDB-style files is described here.)

Timeline for d1zfja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zfja4