Lineage for d1eepb_ (1eep B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080657Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 2080658Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species)
  7. 2080672Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [51415] (1 PDB entry)
  8. 2080674Domain d1eepb_: 1eep B: [28637]
    complexed with so4

Details for d1eepb_

PDB Entry: 1eep (more details), 2.4 Å

PDB Description: 2.4 a resolution crystal structure of borrelia burgdorferi inosine 5'-monphosphate dehydrogenase in complex with a sulfate ion
PDB Compounds: (B:) inosine 5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d1eepb_:

Sequence, based on SEQRES records: (download)

>d1eepb_ c.1.5.1 (B:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
nkitkealtfddvsliprkssvlpsevslktqltknislnipflssamdtvtesqmaiai
akeggigiihknmsieaqrkeiekvktykfqktintngdtneqkpeiftakqhleksday
knaehkedfpnackdlnnklrvgaavsididtierveelvkahvdilvidsahghstrii
elikkiktkypnldliagnivtkeaaldlisvgadclkvgigpgsicttrivagvgvpqi
taicdvyeacnntniciiadggirfsgdvvkaiaagadsvmignlfagtkespseeiiyn
gkkfksyvgmgsisamkrgsksryfqlennepkklvpegiegmvpysgklkdiltqlkgg
lmsgmgylgaatisdlkinskfvkish

Sequence, based on observed residues (ATOM records): (download)

>d1eepb_ c.1.5.1 (B:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
nkitkealtfddvsliprkssvlpsevslktqltknislnipflssamdtvtesqmaiai
akeggigiihknmsieaqrkeiekvktydfpnackdlnnklrvgaavsididtierveel
vkahvdilvidsahghstriielikkiktkypnldliagnivtkeaaldlisvgadclkv
gigpgsicttrivagvgvpqitaicdvyeacnntniciiadggirfsgdvvkaiaagads
vmignlfagtkespseeiiyngkkfksygmvpysgklkdiltqlkgglmsgmgylgaati
sdlkinskfvkish

SCOPe Domain Coordinates for d1eepb_:

Click to download the PDB-style file with coordinates for d1eepb_.
(The format of our PDB-style files is described here.)

Timeline for d1eepb_: