Lineage for d1h7xc2 (1h7x C:533-844)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828102Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species)
  7. 2828103Species Pig (Sus scrofa) [TaxId:9823] [51411] (9 PDB entries)
  8. 2828130Domain d1h7xc2: 1h7x C:533-844 [28634]
    Other proteins in same PDB: d1h7xa1, d1h7xa3, d1h7xa4, d1h7xa5, d1h7xb1, d1h7xb3, d1h7xb4, d1h7xb5, d1h7xc1, d1h7xc3, d1h7xc4, d1h7xc5, d1h7xd1, d1h7xd3, d1h7xd4, d1h7xd5
    complexed with fad, fmn, ndp, sf4, urf; mutant
    has additional subdomain(s) that are not in the common domain
    has additional insertions and/or extensions that are not grouped together

Details for d1h7xc2

PDB Entry: 1h7x (more details), 2.01 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex of a mutant enzyme (c671a), nadph and 5-fluorouracil
PDB Compounds: (C:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1h7xc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7xc2 c.1.4.1 (C:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlsaphgmgergmglacgqdpelvrnicrwvrqavqipffakltp
nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp
ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct
glkallylksie

SCOPe Domain Coordinates for d1h7xc2:

Click to download the PDB-style file with coordinates for d1h7xc2.
(The format of our PDB-style files is described here.)

Timeline for d1h7xc2: