Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins) |
Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51411] (5 PDB entries) |
Domain d1h7wd2: 1h7w D:533-844 [28631] Other proteins in same PDB: d1h7wa1, d1h7wa3, d1h7wa4, d1h7wa5, d1h7wb1, d1h7wb3, d1h7wb4, d1h7wb5, d1h7wc1, d1h7wc3, d1h7wc4, d1h7wc5, d1h7wd1, d1h7wd3, d1h7wd4, d1h7wd5 complexed with fad, fmn, fs4 |
PDB Entry: 1h7w (more details), 1.9 Å
SCOP Domain Sequences for d1h7wd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7wd2 c.1.4.1 (D:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct glkallylksie
Timeline for d1h7wd2:
View in 3D Domains from same chain: (mouse over for more information) d1h7wd1, d1h7wd3, d1h7wd4, d1h7wd5 |