Lineage for d1ldcb_ (1ldc B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. Protein Flavocytochrome b2, C-terminal domain [51408] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51409] (11 PDB entries)
    Uniprot P00175
    N-terminal domain homologous to cytochrome b5
  8. Domain d1ldcb_: 1ldc B: [28627]
    Other proteins in same PDB: d1ldca2
    complexed with fmn, hem, pyr; mutant
    has additional subdomain(s) that are not in the common domain
    has additional insertions and/or extensions that are not grouped together

Details for d1ldcb_

PDB Entry: 1ldc (more details), 2.9 Å

PDB Description: x-ray structure of two complexes of the y143f flavocytochrome b2 mutant crystallized in the presence of lactate or phenyl-lactate
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1ldcb_:

Sequence, based on SEQRES records: (download)

>d1ldcb_ c.1.4.1 (B:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tkediarkeqlksllppldniinlydfeylasqtltkqawafyssgandevthrenhnay
hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
dapslgqrekdmklkfsntkagpkamkktnveesqgasralskfidpsltwkdieelkkk
tklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlk
dklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeiems
mrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda

Sequence, based on observed residues (ATOM records): (download)

>d1ldcb_ c.1.4.1 (B:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tkediarkeqlksllppldniinlydfeylasqtltkqawafyssgandevthrenhnay
hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
dapslgqrekdmklkfidpsltwkdieelkkktklpivikgvqrtedvikaaeigvsgvv
lsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkalclgakgv
glgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlstlkartvg
vpndvlynevyegptltefeda

SCOPe Domain Coordinates for d1ldcb_ are not available.

Timeline for d1ldcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ldca1, d1ldca2