Lineage for d1ldca1 (1ldc A:98-511)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 172977Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 172978Family c.1.4.1: FMN-linked oxidoreductases [51396] (11 proteins)
  6. 173030Protein Flavocytochrome b2, C-terminal domain [51408] (1 species)
  7. 173031Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51409] (7 PDB entries)
  8. 173044Domain d1ldca1: 1ldc A:98-511 [28626]
    Other proteins in same PDB: d1ldca2

Details for d1ldca1

PDB Entry: 1ldc (more details), 2.9 Å

PDB Description: x-ray structure of two complexes of the y143f flavocytochrome b2 mutant crystallized in the presence of lactate or phenyl-lactate

SCOP Domain Sequences for d1ldca1:

Sequence, based on SEQRES records: (download)

>d1ldca1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
apgetkediarkeqlksllppldniinlydfeylasqtltkqawafyssgandevthren
hnayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcg
qgvtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkal
fvtvdapslgqrekdmklkfsntkagpkamkktnveesqgasralskfidpsltwkdiee
lkkktklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileq
rnlkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrde
iemsmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda

Sequence, based on observed residues (ATOM records): (download)

>d1ldca1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
apgetkediarkeqlksllppldniinlydfeylasqtltkqawafyssgandevthren
hnayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcg
qgvtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkal
fvtvdapslgqrekdmklkalskfidpsltwkdieelkkktklpivikgvqrtedvikaa
eigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlka
lclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldls
tlkartvgvpndvlynevyegptltefeda

SCOP Domain Coordinates for d1ldca1:

Click to download the PDB-style file with coordinates for d1ldca1.
(The format of our PDB-style files is described here.)

Timeline for d1ldca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ldca2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ldcb1