Lineage for d1lcob_ (1lco B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814735Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 814736Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)
  6. 814860Protein Flavocytochrome b2, C-terminal domain [51408] (1 species)
  7. 814861Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51409] (11 PDB entries)
    Uniprot P00175
    N-terminal domain homologous to cytochrome b5
  8. 814873Domain d1lcob_: 1lco B: [28625]
    Other proteins in same PDB: d1lcoa2
    complexed with fmn, hem, ppy; mutant

Details for d1lcob_

PDB Entry: 1lco (more details), 2.9 Å

PDB Description: x-ray structure of two complexes of the y143f flavocytochrome b2 mutant crystallized in the presence of lactate or phenyl-lactate
PDB Compounds: (B:) l-lactate dehydrogenase

SCOP Domain Sequences for d1lcob_:

Sequence, based on SEQRES records: (download)

>d1lcob_ c.1.4.1 (B:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tkediarkeqlksllppldniinlydfeylasqtltkqawafyssgandevthrenhnay
hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
dapslgqrekdmklkfsntkagpkamkktnveesqgasralskfidpsltwkdieelkkk
tklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlk
dklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeiems
mrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda

Sequence, based on observed residues (ATOM records): (download)

>d1lcob_ c.1.4.1 (B:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tkediarkeqlksllppldniinlydfeylasqtltkqawafyssgandevthrenhnay
hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
dapslgqrekdmklkqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
stlkartvgvpndvlynevyegptltefeda

SCOP Domain Coordinates for d1lcob_:

Click to download the PDB-style file with coordinates for d1lcob_.
(The format of our PDB-style files is described here.)

Timeline for d1lcob_: