Lineage for d1lcoa1 (1lco A:98-511)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473648Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 473649Family c.1.4.1: FMN-linked oxidoreductases [51396] (15 proteins)
  6. 473736Protein Flavocytochrome b2, C-terminal domain [51408] (1 species)
  7. 473737Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51409] (10 PDB entries)
    N-terminal domain homologous to cytochrome b5
  8. 473748Domain d1lcoa1: 1lco A:98-511 [28624]
    Other proteins in same PDB: d1lcoa2

Details for d1lcoa1

PDB Entry: 1lco (more details), 2.9 Å

PDB Description: x-ray structure of two complexes of the y143f flavocytochrome b2 mutant crystallized in the presence of lactate or phenyl-lactate

SCOP Domain Sequences for d1lcoa1:

Sequence, based on SEQRES records: (download)

>d1lcoa1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
apgetkediarkeqlksllppldniinlydfeylasqtltkqawafyssgandevthren
hnayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcg
qgvtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkal
fvtvdapslgqrekdmklkfsntkagpkamkktnveesqgasralskfidpsltwkdiee
lkkktklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileq
rnlkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrde
iemsmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda

Sequence, based on observed residues (ATOM records): (download)

>d1lcoa1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
apgetkediarkeqlksllppldniinlydfeylasqtltkqawafyssgandevthren
hnayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcg
qgvtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkal
fvtvdapslgqrekdmklkfsalskfidpsltwkdieelkkktklpivikgvqrtedvik
aaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvl
kalclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlld
lstlkartvgvpndvlynevyegptltefeda

SCOP Domain Coordinates for d1lcoa1:

Click to download the PDB-style file with coordinates for d1lcoa1.
(The format of our PDB-style files is described here.)

Timeline for d1lcoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lcoa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1lcob_