Lineage for d1fcbb_ (1fcb B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080236Protein Flavocytochrome b2, C-terminal domain [51408] (1 species)
  7. 2080237Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51409] (11 PDB entries)
    Uniprot P00175
    N-terminal domain homologous to cytochrome b5
  8. 2080245Domain d1fcbb_: 1fcb B: [28621]
    Other proteins in same PDB: d1fcba2
    complexed with fmn, hem, pyr

Details for d1fcbb_

PDB Entry: 1fcb (more details), 2.4 Å

PDB Description: molecular structure of flavocytochrome b2 at 2.4 angstroms resolution
PDB Compounds: (B:) flavocytochrome b2

SCOPe Domain Sequences for d1fcbb_:

Sequence, based on SEQRES records: (download)

>d1fcbb_ c.1.4.1 (B:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqg
vtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
tvdapslgqrekdmklkfsntkagpkamkktnveesqgasralskfidpsltwkdieelk
kktklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrn
lkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeie
msmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda

Sequence, based on observed residues (ATOM records): (download)

>d1fcbb_ c.1.4.1 (B:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqg
vtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
tvdapslgqrekdmklkfsnveesqgasralskfidpsltwkdieelkkktklpivikgv
qrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdgg
vrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsia
elkpdlldlstlkartvgvpndvlynevyegptltefeda

SCOPe Domain Coordinates for d1fcbb_:

Click to download the PDB-style file with coordinates for d1fcbb_.
(The format of our PDB-style files is described here.)

Timeline for d1fcbb_: