Lineage for d1fcba1 (1fcb A:98-511)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64537Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 64538Family c.1.4.1: FMN-linked oxidoreductases [51396] (9 proteins)
  6. 64570Protein Flavocytochrome b2, C-terminal domain [51408] (1 species)
  7. 64571Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51409] (5 PDB entries)
  8. 64574Domain d1fcba1: 1fcb A:98-511 [28620]
    Other proteins in same PDB: d1fcba2

Details for d1fcba1

PDB Entry: 1fcb (more details), 2.4 Å

PDB Description: molecular structure of flavocytochrome b2 at 2.4 angstroms resolution

SCOP Domain Sequences for d1fcba1:

Sequence, based on SEQRES records: (download)

>d1fcba1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
apgetkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthren
hnayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcg
qgvtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkal
fvtvdapslgqrekdmklkfsntkagpkamkktnveesqgasralskfidpsltwkdiee
lkkktklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileq
rnlkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrde
iemsmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda

Sequence, based on observed residues (ATOM records): (download)

>d1fcba1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
apgetkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthren
hnayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcg
qgvtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkal
fvtvdapslgqrekdmklkfsngasralskfidpsltwkdieelkkktklpivikgvqrt
edvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrr
gtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelk
pdlldlstlkartvgvpndvlynevyegptltefeda

SCOP Domain Coordinates for d1fcba1:

Click to download the PDB-style file with coordinates for d1fcba1.
(The format of our PDB-style files is described here.)

Timeline for d1fcba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fcba2
View in 3D
Domains from other chains:
(mouse over for more information)
d1fcbb1