Lineage for d1ltdb_ (1ltd B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 235977Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 235978Family c.1.4.1: FMN-linked oxidoreductases [51396] (11 proteins)
  6. 236035Protein Flavocytochrome b2, C-terminal domain [51408] (1 species)
  7. 236036Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51409] (7 PDB entries)
    N-terminal domain homologous to cytochrome b5
  8. 236040Domain d1ltdb_: 1ltd B: [28619]
    Other proteins in same PDB: d1ltda2
    complexed with fmn, hem, so3

Details for d1ltdb_

PDB Entry: 1ltd (more details), 2.6 Å

PDB Description: the 2.6 angstroms refined structure of the escherichia coli recombinant saccharomyces cerevisiae flavocytochrome b2-sulphite complex

SCOP Domain Sequences for d1ltdb_:

Sequence, based on SEQRES records: (download)

>d1ltdb_ c.1.4.1 (B:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
tkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhnay
hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
dapslgqrekdmklkfsntkagpkamkktnveesqgasralskfidpsltwkdieelkkk
tklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlk
dklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeiems
mrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda

Sequence, based on observed residues (ATOM records): (download)

>d1ltdb_ c.1.4.1 (B:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
tkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhnay
hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
dapslgqrekdmklkfsnskfidpsltwkdieelkkktklpivikgvqrtedvikaaeig
vsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkalcl
gakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlstlk
artvgvpndvlynevyegptltefeda

SCOP Domain Coordinates for d1ltdb_:

Click to download the PDB-style file with coordinates for d1ltdb_.
(The format of our PDB-style files is described here.)

Timeline for d1ltdb_: