SCOPe 2.02: Domain d2tmdb1: 2tmd B:1-340

Lineage for d2tmdb1 (2tmd B:1-340)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein Trimethylamine dehydrogenase, N-terminal domain [51406] (1 species)
   two other domains are alpha/beta Rossmann-like fold and beta/beta/alpha fold

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51407] (5 PDB entries)

8. Domain d2tmdb1: 2tmd B:1-340 [28617]
   Other proteins in same PDB: d2tmda2, d2tmda3, d2tmdb2, d2tmdb3
   complexed with adp, fmn, sf4

Details for d2tmdb1

PDB Entry: 2tmd, 2.4 Å

PDB Description: correlation of x-ray deduced and experimental amino acid sequences of trimethylamine dehydrogenase

PDB Compounds: (B:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d2tmdb1:

Sequence; same for both SEQRES and ATOM records:

>d2tmdb1 c.1.4.1 (B:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ardpkhdilfepiqigpktlrnrfyqvphcigagsdkpgfqsahrsvkaeggwaalntey
csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
tdpekmieivtkgyadiigcarpsiadpflpqkveqgryd

Timeline for d2tmdb1:

• d2tmdb1 first appeared (with stable ids) in SCOP 1.55
  
• d2tmdb1 appears in SCOPe 2.01
  
• d2tmdb1 appears in SCOPe 2.03
  
• d2tmdb1 appears in the current release, SCOPe 2.08