Lineage for d2tmda1 (2tmd A:1-340)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1567263Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1567264Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. Protein Trimethylamine dehydrogenase, N-terminal domain [51406] (1 species)
    two other domains are alpha/beta Rossmann-like fold and beta/beta/alpha fold
  7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51407] (5 PDB entries)
  8. 1567643Domain d2tmda1: 2tmd A:1-340 [28616]
    Other proteins in same PDB: d2tmda2, d2tmda3, d2tmdb2, d2tmdb3
    complexed with adp, fmn, sf4

Details for d2tmda1

PDB Entry: 2tmd (more details), 2.4 Å

PDB Description: correlation of x-ray deduced and experimental amino acid sequences of trimethylamine dehydrogenase
PDB Compounds: (A:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d2tmda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tmda1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ardpkhdilfepiqigpktlrnrfyqvphcigagsdkpgfqsahrsvkaeggwaalntey
csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
tdpekmieivtkgyadiigcarpsiadpflpqkveqgryd

SCOPe Domain Coordinates for d2tmda1:

Click to download the PDB-style file with coordinates for d2tmda1.
(The format of our PDB-style files is described here.)

Timeline for d2tmda1: