Lineage for d1djna1 (1djn A:1-340)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18552Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 18553Family c.1.4.1: FMN-linked oxidoreductases [51396] (6 proteins)
  6. 18604Protein Trimethylamine dehydrogenase, N-terminal domain [51406] (1 species)
  7. 18605Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51407] (3 PDB entries)
  8. 18606Domain d1djna1: 1djn A:1-340 [28612]
    Other proteins in same PDB: d1djna2, d1djna3, d1djnb2, d1djnb3

Details for d1djna1

PDB Entry: 1djn (more details), 2.2 Å

PDB Description: structural and biochemical characterization of recombinant wild type trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)

SCOP Domain Sequences for d1djna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djna1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1}
ardpkhdilfepiqigpktlrnrfyqvphcigagsdkpgfqsahrsvkaeggwaalntey
csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
tdpekmieivtkgyadiigcarpsiadpflpqkveqgryd

SCOP Domain Coordinates for d1djna1:

Click to download the PDB-style file with coordinates for d1djna1.
(The format of our PDB-style files is described here.)

Timeline for d1djna1: