Lineage for d1gyla_ (1gyl A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18552Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 18553Family c.1.4.1: FMN-linked oxidoreductases [51396] (6 proteins)
  6. 18589Protein Glycolate oxidase [51404] (1 species)
  7. 18590Species Spinach (Spinacia oleracea) [TaxId:3562] [51405] (4 PDB entries)
  8. 18594Domain d1gyla_: 1gyl A: [28610]

Details for d1gyla_

PDB Entry: 1gyl (more details), 3 Å

PDB Description: involvement of tyr24 and trp108 in substrate binding and substrate specificity of glycolate oxidase

SCOP Domain Sequences for d1gyla_:

Sequence, based on SEQRES records: (download)

>d1gyla_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea)}
meitnvneyeaiakqklpkmvydfyasgaedqwtlaenrnafsrilfrprilidvtnidm
tttilgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastg
pgirffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppfltl
knfegidlgkmdkandsglssyvagqidrslswkdvawlqtitslpilvkgvitaedarl
avqhgaagiivsnhgarqldyvpatimaleevvkaaqgripvfldggvrrgtdvfkalal
gaagvfigrpvvfslaaegeagvkkvlqmmrdefeltmalsgcrslkeisrshiaadwd

Sequence, based on observed residues (ATOM records): (download)

>d1gyla_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea)}
meitnvneyeaiakqklpkmvydfyasgaedqwtlaenrnafsrilfrprilidvtnidm
tttilgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastg
pgirffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppfltl
knfegidlgkglssyvagqidrslswkdvawlqtitslpilvkgvitaedarlavqhgaa
giivsnhgarqldyvpatimaleevvkaaqgripvfldggvrrgtdvfkalalgaagvfi
grpvvfslaaegeagvkkvlqmmrdefeltmalsgcrslkeisrshiaadwd

SCOP Domain Coordinates for d1gyla_:

Click to download the PDB-style file with coordinates for d1gyla_.
(The format of our PDB-style files is described here.)

Timeline for d1gyla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gylb_