Lineage for d1gyla_ (1gyl A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080260Protein Glycolate oxidase [51404] (1 species)
  7. 2080261Species Spinach (Spinacia oleracea) [TaxId:3562] [51405] (4 PDB entries)
  8. 2080265Domain d1gyla_: 1gyl A: [28610]
    complexed with fmn

Details for d1gyla_

PDB Entry: 1gyl (more details), 3 Å

PDB Description: involvement of tyr24 and trp108 in substrate binding and substrate specificity of glycolate oxidase
PDB Compounds: (A:) glycolate oxidase

SCOPe Domain Sequences for d1gyla_:

Sequence, based on SEQRES records: (download)

>d1gyla_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]}
meitnvneyeaiakqklpkmvydfyasgaedqwtlaenrnafsrilfrprilidvtnidm
tttilgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastg
pgirffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppfltl
knfegidlgkmdkandsglssyvagqidrslswkdvawlqtitslpilvkgvitaedarl
avqhgaagiivsnhgarqldyvpatimaleevvkaaqgripvfldggvrrgtdvfkalal
gaagvfigrpvvfslaaegeagvkkvlqmmrdefeltmalsgcrslkeisrshiaadwd

Sequence, based on observed residues (ATOM records): (download)

>d1gyla_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]}
meitnvneyeaiakqklpkmvydfyasgaedqwtlaenrnafsrilfrprilidvtnidm
tttilgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastg
pgirffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppfltl
knfegidlgkglssyvagqidrslswkdvawlqtitslpilvkgvitaedarlavqhgaa
giivsnhgarqldyvpatimaleevvkaaqgripvfldggvrrgtdvfkalalgaagvfi
grpvvfslaaegeagvkkvlqmmrdefeltmalsgcrslkeisrshiaadwd

SCOPe Domain Coordinates for d1gyla_:

Click to download the PDB-style file with coordinates for d1gyla_.
(The format of our PDB-style files is described here.)

Timeline for d1gyla_: